Protein Info for ABZR86_RS09175 in Dyella japonica UNC79MFTsu3.2

Annotation: catecholate siderophore receptor Fiu

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 775 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF07715: Plug" amino acids 83 to 184 (102 residues), 78.5 bits, see alignment E=7.8e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 85 to 775 (691 residues), 283.1 bits, see alignment E=2.6e-88 PF00593: TonB_dep_Rec" amino acids 289 to 743 (455 residues), 203.5 bits, see alignment E=1.8e-63 PF14905: OMP_b-brl_3" amino acids 391 to 756 (366 residues), 34.1 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 51% identical to FIU_ECO57: Catecholate siderophore receptor Fiu (fiu) from Escherichia coli O157:H7

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 62% identity to del:DelCs14_5255)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2D8I7 at UniProt or InterPro

Protein Sequence (775 amino acids)

>ABZR86_RS09175 catecholate siderophore receptor Fiu (Dyella japonica UNC79MFTsu3.2)
MAYIKSRKHSVPTARLQPGQLAVATAALLTGLALATPALAADDTAADPQAAKAKSLTAVN
VEATRGSDYVADKVDSPKFTQPLLDTTQTISVITKDLFLQQGATTLTEALRNTPGVGTFY
AGENGSTTTGDGIYMRGFDTSNSIFVDGVRDTGTISRDIFNIEQVEVTKGPAGTDYGRTA
PTGAINLVTKQPLLQNAISGQLAYGSSDRKRATADWNQVLGADSAFRLNLMAQNSGTPGR
DEVENNRWAFAPSLAFGLGTATRVYIDYLHVKQNNIPDGGVSTIGLPGYSSPDPARPWLA
SARPVDPSNFYGTDADHDHVKADLFTVLLEHDFSDDLALRNTLRWGRTRQDYLLTSFMAT
AANLLTPNANDPSTWTVARSNPTFKDQTNKILTDQFNLRANFQTGSITHNLSSGIELTRE
EADTTGVVSLVNTWPKANLYRPDPHVTGMQWFRNGSYTHGKTDTYSAYVFDTLKFNEQWQ
VNAGVRLDHYQTDFDSAVTCGGRNAPACGALPANTAVPGLDARKSGNLTNWKVGVLYKPA
PNGSVYANYAISQQPPGGSTLTLSSSANSADNPNFDPQKAKTAEVGTKWEFYDSRLMLTG
AIYRTEINNDVVQDPVDLQYYQTGKKRVQGVELSAVGKLTEQWAISAGYTVMDSKVISGS
KVTSDGSTDLAYTPKSAFTAWTTYTLPFGLTVGGGARYNGQLKRGTDGAIGTPAYTKSYW
VFDAVATYPINKHVDLQLNLYNLFDKEYVAAINKSGYRYTPGAPRSAMLTANVRF