Protein Info for ABZR86_RS09130 in Dyella japonica UNC79MFTsu3.2

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details PF04403: PqiA" amino acids 48 to 196 (149 residues), 119 bits, see alignment E=8.7e-39

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 43% identity to ppf:Pput_3141)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2D9J5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>ABZR86_RS09130 paraquat-inducible protein A (Dyella japonica UNC79MFTsu3.2)
MADSQPLLICEHCDTVYRRRELCCGEIARCLRCDAILERHHRLGVGAMFALVVTAMLVFV
QANVWPIVTLGLSGQMISTTLWGAIVMMWREHSQIVSMLAAATLFFFPLGKMLLLGWVLF
FAQQGRRAPGFRLAMVALYRLGPWTMSEVFVLGALVAIVKARVYFEVILNPGIFAYAALT
LLITVFASIDLRRLWELVPERSA