Protein Info for ABZR86_RS09075 in Dyella japonica UNC79MFTsu3.2

Annotation: NrsF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details PF06532: NrsF" amino acids 14 to 214 (201 residues), 80.2 bits, see alignment E=9.4e-27

Best Hits

Predicted SEED Role

"FIG00804596: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DBR4 at UniProt or InterPro

Protein Sequence (217 amino acids)

>ABZR86_RS09075 NrsF family protein (Dyella japonica UNC79MFTsu3.2)
MSDPRNHHALIDALGAELAPVRRLPPPWRRAAGWLLVVAAIAAALFAHYGPEGMLRRWAG
TPDLAWAGVGAVLTAITAAWAAFTLGVPGRSPRWAWLPLAPALLWVGASGLGCLRDWVAP
GTVVAGPHQPIGCLQFILAFSVPLSALLIWLLRRACPLRPVLTAMLIGLASAAASASLLE
ICHEFDAAASDLLTHALAVVLVIGINAAMGGRLLQSR