Protein Info for ABZR86_RS09060 in Dyella japonica UNC79MFTsu3.2

Annotation: ribosome silencing factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR00090: ribosome silencing factor" amino acids 18 to 114 (97 residues), 125.1 bits, see alignment E=5.1e-41 PF02410: RsfS" amino acids 19 to 114 (96 residues), 116.5 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 47% identical to IOJAP_CHRVO: Ribosomal silencing factor RsfS (rsfS) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K09710, ribosome-associated protein (inferred from 68% identity to xcv:XCV2933)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DAX9 at UniProt or InterPro

Protein Sequence (129 amino acids)

>ABZR86_RS09060 ribosome silencing factor (Dyella japonica UNC79MFTsu3.2)
MSQTSQRNKAADTATLRKHVIDALEELKAKDIREIDVRGKTSIADLLVIASGTSARHVKS
IADEVVKFAKKAGVMPLGVEGEQEAEWVLVDLGDVIVHVMLPRIREFYGLERLWTVGDRE
QDSQAVGAG