Protein Info for ABZR86_RS09035 in Dyella japonica UNC79MFTsu3.2

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 215 to 233 (19 residues), see Phobius details PF03741: TerC" amino acids 17 to 206 (190 residues), 159.8 bits, see alignment E=9.2e-51 PF00571: CBS" amino acids 375 to 424 (50 residues), 29.5 bits, see alignment 1.1e-10 PF03471: CorC_HlyC" amino acids 441 to 515 (75 residues), 69.8 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: None (inferred from 58% identity to rru:Rru_A2870)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DBK5 at UniProt or InterPro

Protein Sequence (517 amino acids)

>ABZR86_RS09035 TerC family protein (Dyella japonica UNC79MFTsu3.2)
MFAFDWLADPTAWIGLFTLVVLEIVLGIDNLVFIAILADKLPPQQRDRARLMGLGLALAM
RLVLLGAMSWLVKLTAPLFDWNGFSLSWRDIILLLGGVFLLFKATLELHERLEGGDGHEG
GNRAHARFWLVVTQIVVLDAVFSLDSVITAVGMVDQLSVMMIAVVIAMILMISASKPLTA
FVNARPTVVILCLSFLLMIGFSLVAEGLGFHIPKGYLYAAIGFSIMIEVFNQTMRRNRRR
LLFSSPRKLRDRTARAVLRLLGAGGEEEEDVSKAADTAADTGIGVFGKDELAMVRGVLDL
AQRPVRSIMTPRTEINWVDPREDAETLRAEVTASSHAWLPVAGDDLDQLVGVASSRDLLA
SLLEHGRIETGQVVRKPLTVLESLSVLRLIDEFRRSPLQVALVVDEYGSVLGLVTPTDVL
ETIAGEFPGEDSGDPSAVQETSGAWLLDGGLDLRRAEHLLNRTLSGDGSFSTLAGYVLEQ
LGRLPREGDSLDSEGLRFEVMAMDGARIERLRVTPAD