Protein Info for ABZR86_RS08905 in Dyella japonica UNC79MFTsu3.2
Annotation: carbonate dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to CAN_ECOLI: Carbonic anhydrase 2 (can) from Escherichia coli (strain K12)
KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 63% identity to psu:Psesu_1684)MetaCyc: 51% identical to carbonic anhydrase 2 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]
Predicted SEED Role
"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)
MetaCyc Pathways
- CO2 fixation into oxaloacetate (anaplerotic) (2/2 steps found)
- cyanate degradation (2/3 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
- C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
- 3-hydroxypropanoate cycle (8/13 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
- glyoxylate assimilation (6/13 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.1
Use Curated BLAST to search for 4.2.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1I2DEJ5 at UniProt or InterPro
Protein Sequence (222 amino acids)
>ABZR86_RS08905 carbonate dehydratase (Dyella japonica UNC79MFTsu3.2) MNNPLQDLLDSNRRWSAAVRGDDPHFFERLAQQQAPKYLWIGCSDSRVPATQIVDLPPGD IFVQRNVANVVSHTDLNCLSAIQFAVDVLKVEHILVVGHYGCGGVQAVLDDRRLGLVDNW LRHVGDVAQKHTGMLAALDPMQLRNTRLCELNAIEQVVNVCHTTMVMDAWERGQKLSVHA WCYSLSDGHINDLGLHVSSREQLYPAYQDALQRLTTGPALPR