Protein Info for ABZR86_RS08845 in Dyella japonica UNC79MFTsu3.2

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR00416: DNA repair protein RadA" amino acids 1 to 455 (455 residues), 636.9 bits, see alignment E=9.2e-196 PF18073: Rubredoxin_2" amino acids 8 to 35 (28 residues), 41.7 bits, see alignment (E = 2.1e-14) PF06745: ATPase" amino acids 79 to 149 (71 residues), 39.6 bits, see alignment E=1.2e-13 PF13481: AAA_25" amino acids 84 to 225 (142 residues), 42.4 bits, see alignment E=1.8e-14 PF13401: AAA_22" amino acids 96 to 220 (125 residues), 34.8 bits, see alignment E=6e-12 PF09848: SLFN-g3_helicase" amino acids 96 to 220 (125 residues), 20.3 bits, see alignment E=9.1e-08 PF13541: ChlI" amino acids 349 to 433 (85 residues), 39.4 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 65% identical to RADA_PSEAE: DNA repair protein RadA (radA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 76% identity to xcc:XCC1164)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DFG8 at UniProt or InterPro

Protein Sequence (459 amino acids)

>ABZR86_RS08845 DNA repair protein RadA (Dyella japonica UNC79MFTsu3.2)
MAKAKTAYVCADCGAEHSKWQGQCIECGAWNTLSEFVVQPAVKSAGAARSSGYAGAAAGA
PKVTPLTAVALTAELRTLTGIGELDRVLGGGLVDGSVVLIGGDPGIGKSTLLLQMLGKLG
EQLASVYVTGEESLAQVAARAQRLDLPLGPLHALAETCIERILEQAVSARPRVLVIDSIQ
TIWTELLTAAPGSVSQVRESAAKLTRFAKETGTSVFLVGHVTKEGGIAGPRVLEHMVDAV
LYFEGESGSRFRVLRAFKNRFGAVNELGVFAMSEKGLREVPNPSAIFLSAHAGPTSGSAV
MVTREGTRPLLVEVQALVDQSSLGNPRRVALGLEQNRLAMLLAVLHRHGGVAAYDQDVFV
NVVGGIRVQETAADLPVLLAVLSSLRDRPLPEKTIAFGEVGLSGEIRPVPNGDERLKEAA
HHGFQRAIVPKANAPKKGKVGELEVAGVERLSQAIDACR