Protein Info for ABZR86_RS08765 in Dyella japonica UNC79MFTsu3.2

Annotation: GTP cyclohydrolase FolE2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF02649: GCHY-1" amino acids 11 to 301 (291 residues), 240.8 bits, see alignment E=9.4e-76

Best Hits

Swiss-Prot: 50% identical to GCH4_ALCBS: GTP cyclohydrolase FolE2 (folE2) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K09007, hypothetical protein (inferred from 56% identity to gpb:HDN1F_29230)

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DH98 at UniProt or InterPro

Protein Sequence (317 amino acids)

>ABZR86_RS08765 GTP cyclohydrolase FolE2 (Dyella japonica UNC79MFTsu3.2)
MYTQEQTARLLPDVAHHAQPHLAGALDWVGMDGIEVPVRFDAGDGEPQRASARVGAFVNL
HRPDKRGIHMSRLYLLVEHALSAGQLTAGALRDLLHAFLESHKDLSDRACLSIRFEQLVR
RPALRSGNSGWRAYPVCIEASMVGEDFLLEYGTEVVYSSTCPASAALSRQLIQDQFARDF
DVSHPLEHAAVLAWLGSERGIVATPHAQRSVARLRVRVAAGGAFHLIKLIDRVEQALGTP
VQTAVKREDEQAFALANGSNLMFCEDAARRIQKALDADANLADFHIRVEHQESLHPHDAV
AYASKGVAGGLGGAARA