Protein Info for ABZR86_RS08730 in Dyella japonica UNC79MFTsu3.2

Annotation: N-acetylornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF02729: OTCace_N" amino acids 4 to 161 (158 residues), 129.1 bits, see alignment E=1.5e-41 PF00185: OTCace" amino acids 184 to 330 (147 residues), 108.2 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 80% identical to AOTC_XANCP: N-acetylornithine carbamoyltransferase (argF') from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K09065, N-acetylornithine carbamoyltransferase [EC: 2.1.3.9] (inferred from 80% identity to xca:xccb100_1930)

MetaCyc: 80% identical to acetylornithine transcarbamylase subunit (Xanthomonas campestris)
N-acetylornithine carbamoyltransferase. [EC: 2.1.3.9]

Predicted SEED Role

"N-acetylornithine carbamoyltransferase (EC 2.1.3.9)" in subsystem Arginine Biosynthesis extended (EC 2.1.3.9)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DHU8 at UniProt or InterPro

Protein Sequence (335 amino acids)

>ABZR86_RS08730 N-acetylornithine carbamoyltransferase (Dyella japonica UNC79MFTsu3.2)
MTLRHFLTTQDYSRAEIDALLEQAAAFKRSPRGQQLAGKSVALLFFNPSMRTRTSFELGA
FHLGGHAIVLAPGKDAWPIEFDVGTVMDGDTEEHIAEVARVLSRYVDLIAVRAFPKFQDW
TVDREDRVIKAFAQYASVPVINMETITHPCQELAHALAMQEHLGSLQNKKYVLTWTYHPK
PLNTAVANSALLIATKMGMDVTLLCPTPDYVLDDRYMQAGYANAQANGGSLRISHDIDEA
YSGADVVYAKSWGALPFFGRWEQEKPIRDAHKHFIVDERKMALTNNGLFSHCLPLRRNVK
ATDAVMDAPYCIAIDEAENRLHVQKAVMATLLGQR