Protein Info for ABZR86_RS08715 in Dyella japonica UNC79MFTsu3.2

Updated annotation (from data): arginosuccinate synthetase (EC 6.3.4.5)
Rationale: Important for fitness in most defined media, except when arginine is provided. 35% identical to argininosuccinate synthase from Thermus thermophilus (P59846).
Original annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00764: Arginosuc_synth
  • amino acids 5 to 166 (162 residues), 113.8 bits, E=8.7e-37
• PF20979: Arginosuc_syn_C
  • amino acids 175 to 390 (216 residues), 146.7 bits, E=8e-47

Best Hits

Swiss-Prot: 84% identical to ASSY_XANCP: Argininosuccinate synthase (argG) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 86% identity to psu:Psesu_1225)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (8/10 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (3/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See A0A1I2DIG3 at UniProt or InterPro

Protein Sequence (398 amino acids)

>ABZR86_RS08715 arginosuccinate synthetase (EC 6.3.4.5) (Dyella japonica UNC79MFTsu3.2)
MSKDIVLAFSGGLDTSFCVPYLKERGWNVHTVFADTGGVDAEERAYIEARAQELGVASHV
TVDGGPAIWNGFVKPFVWAGEGYQGQYPLLVSDRYLIVDAAIQRCAELGTRAIAHGCTGM
GNDQVRFDLAVKALGDYEIVAPIREIQKEHTQTRAYEQAYLEERGFPVRAKQKSYTINEN
LLGVTLSGGEIDLWKAPGEGARGWCKPRAEWPSEKLSVTLGFEHGEAVSLNGEKLPGAKI
LARLNELFAPYGVGRGMYTGDTTIGLKGRIVYEAPGLISLLAAHRALEEAVLTKQQNRFK
PEIARKWVEVVYEGFFHDPVKTDLEAFLASSQQQVNGDVVLETSGAQVTAVEVRSPHILN
AKGATYAQSADWGVAEAEGFIKLFGMSSTLWAEVNRKG