Protein Info for ABZR86_RS08710 in Dyella japonica UNC79MFTsu3.2

Updated annotation (from data): N-acetylcitrulline deacetylase (EC 3.5.1.-)
Rationale: Important for fitness in most defined media, except when arginine is provided. 70% identical to argE¡¯ from Xanthomona campestris (Q8P8J5), which is active on both N-acetylornithine and N-acetylcitrulline. But only the N-acetylcitrulline activity is expected to be relevant (see N-acetylornithine carbamoyltransferase N515DRAFT_3763)
Original annotation: acetylornithine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01546: Peptidase_M20
  • amino acids 67 to 362 (296 residues), 69.6 bits, E=3.8e-23
• PF07687: M20_dimer
  • amino acids 163 to 268 (106 residues), 53.5 bits, E=2.1e-18

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 72% identity to xoo:XOO2673)

MetaCyc: 70% identical to acetylcitrulline deacetylase subunit (Xanthomonas campestris)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.16

Sequence Analysis Tools

See A0A1I2DJB5 at UniProt or InterPro

Protein Sequence (366 amino acids)

>ABZR86_RS08710 N-acetylcitrulline deacetylase (EC 3.5.1.-) (Dyella japonica UNC79MFTsu3.2)
MSQLLDDTLRHLRALVSHDTRNPPREIGTGGIFDYLREQLAGFEVTVTDFGAGAVNLYAV
RGKPKYLFNVHLDTVPDSPHWSADPHVLRVEGDRAIGLGACDIKGAAAALVAVANATQGD
MALLLSTDEEANDARCIAGFLKDHPVYEAVIVAEPTKGEAVLAHRGIHSVQMRFSGKAGH
ASGEQKPSDSAVHQAVRWGVAALDYVESQAHERFGGLTGLRFNIGKVEGGIKANVIAPTA
DVRFGFRPLPSMDADRMLETFRTLVEPQPVEFGETFRGDSLPAGDTATAETRRLAARDLA
DELGIPVGNAVNFWTEAALFSAAGYISFVYGPGDIAQAHAADEWVALEQLDHYAQTIYRI
VDRGSA