Protein Info for ABZR86_RS08700 in Dyella japonica UNC79MFTsu3.2

Updated annotation (from data): N-acetylglutamylphosphate reductase (EC 1.2.1.38)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR01850.
Original annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 7 to 317 (311 residues), 305 bits, see alignment E=3.7e-95 PF01118: Semialdhyde_dh" amino acids 8 to 123 (116 residues), 85.6 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 69% identical to ARGC_XANAC: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 69% identity to xac:XAC2346)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DJ03 at UniProt or InterPro

Protein Sequence (319 amino acids)

>ABZR86_RS08700 N-acetylglutamylphosphate reductase (EC 1.2.1.38) (Dyella japonica UNC79MFTsu3.2)
MSIDKKTIGIVGARGHTGAELIRLIATHPALELGFVSSRELDGQRVAEHVDGYAGELRYA
NLDPAAVAAQGADVVVLALPNGKAAPYVEAIDAAKPETLILDLSADYRFNERWYYGLPEL
TRGKWRGERRISNPGCYATAIQLSIAPLKDVLAAPPVSFGVSGYSGAGTTPSDKNNPEKL
RDNLMPYSLTGHTHEQEASRHLGLPVEFMPHVAPHFRGLTVTTNLYLVRPMKREEILQRF
RHAYDGEKLVKVVDEAPWVSQIAHRHHAEVGGFAVSVDGKRVVIVATLDNLLKGAATQAI
QNINRAIGVDEYTSIPLEG