Protein Info for ABZR86_RS08685 in Dyella japonica UNC79MFTsu3.2

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 15 to 241 (227 residues), 132.5 bits, E=2.2e-42
• TIGR01027: glutamate 5-kinase
  • amino acids 15 to 373 (359 residues), 392.7 bits, E=8.8e-122
• PF01472: PUA
  • amino acids 284 to 358 (75 residues), 72 bits, E=3.2e-24

Best Hits

Swiss-Prot: 68% identical to PROB_XANC8: Glutamate 5-kinase (proB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 69% identity to xca:xccb100_1940)

MetaCyc: 46% identical to glutamate 5-kinase (Escherichia coli K-12 substr. MG1655)
Glutamate 5-kinase. [EC: 2.7.2.11]

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-N^δ-acetylornithine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

See A0A1I2DJ40 at UniProt or InterPro

Protein Sequence (380 amino acids)

>ABZR86_RS08685 glutamate 5-kinase (Dyella japonica UNC79MFTsu3.2)
MAEHLPAQPLPNWRRAVLKVGSNLLAADGGGLTPRHARALAAFIGDSHAQGRQVVLVSSG
AVAAGRALLRERALPGDDLAARQALAALGQAPMIALWQSLSPRPVAQVLLTHDDLRHRRR
YLNARATLRELLLLDVLPVVNENDTVAVDELKLGDNDNLAAIVAALVDADLLLIASDIDA
LYDADPRRVPSAVPVPHVSTLTAEVMAMAGGSGSAVGTGGMHTKLEAAVKAGAAGVPTVL
FDGRNTETVAALAAGQLHGTLFDAPRSRMQARKYWLRHAPAAPGSILVDDGAARALAGGR
ASLLPGGIVGADGEFHRGDMVEIVDVTRRPVARGLSQYGAAEVRRLAGRHSSAIDAVLGY
SYGAEIVHRDDLVVLAEVHS