Protein Info for ABZR86_RS08680 in Dyella japonica UNC79MFTsu3.2

Annotation: glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF00171: Aldedh" amino acids 11 to 284 (274 residues), 50.7 bits, see alignment E=5.4e-18 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 12 to 402 (391 residues), 456.1 bits, see alignment E=4.7e-141

Best Hits

Swiss-Prot: 74% identical to PROA_XANOR: Gamma-glutamyl phosphate reductase (proA) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 74% identity to psu:Psesu_1235)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DJD8 at UniProt or InterPro

Protein Sequence (420 amino acids)

>ABZR86_RS08680 glutamate-5-semialdehyde dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MSEMRTQALACRDAAQVLAELTTEAKRALLQALADALHAGTGVVLEANARDMAAAREKGV
QGAMLDRLRLDEARVAGIVAALREVAALPDPVGVVTRRETRPNGLEVERVRVPLGVIAMI
YEARPNVTADAAALCLMAGNGVILRGGSEAVHSNTAIAGVLRQALAAQGVPEAALTLVSD
LRRETMVELLQLSDIVDLAIPRGGEGLIRFVAEHARVPVIKHYKGVCHLYVDRAADQALA
LDLLVDGKTSRPGVCNALETLLVHRDIAAEFLPRAADALGRRKVELRGCERSRALVPAMK
PADETDYAAEYLDLILAVRIVDDLEAALAHIHRYSSDHTEVIATRDEDAARRFVRGIRSA
VVMVNASSRFSDGGELGLGAEIGISTTRLHAYGPMGAEALTVERFVVRGDGQVRHPESRT