Protein Info for ABZR86_RS08665 in Dyella japonica UNC79MFTsu3.2

Annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR01814: kynureninase" amino acids 13 to 424 (412 residues), 467.7 bits, see alignment E=1.5e-144 PF00266: Aminotran_5" amino acids 48 to 260 (213 residues), 39.3 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 69% identical to KYNU_STRMK: Kynureninase (kynU) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 69% identity to smt:Smal_2598)

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DJG5 at UniProt or InterPro

Protein Sequence (428 amino acids)

>ABZR86_RS08665 kynureninase (Dyella japonica UNC79MFTsu3.2)
MSNAYQATLEWARAQDAADPLRAFRDEFLIPPHDGRASHYFCGNSLGLQPRAVREALTAE
LDDWGALAVEGHFKGRQPWLDYHEYVRDDLAELVGALPSEVVAMNTLGVNLHLMMVSFYR
PTPDRHAILIEAGAFPTDRYAVESQIRFHGFSPTLSLIELEPDEPNGTLSMGAIERALAE
HGERIALVLLPGVQYRTGQAFDLKAITGLAHRQGCTVGFDLAHAVGNLPLRLHDSGADFA
VWCSYKYLNSGPGAVAGAFVHDRHARTEHLPRFAGWWGHDKQSRFRMGPEFVPTPGADGW
QISNPPILSLAPLRVSLQIFHRAGMARLREKSLRLTGYLEWLVQTQLADVLESVTPRETE
RRGSQLSLRVLGGRERGRALFEYLMEHGVVGDWREPDVIRISPAPLYNRFEDCVGFAEAV
RAWAHRPA