Protein Info for ABZR86_RS08625 in Dyella japonica UNC79MFTsu3.2

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF13420: Acetyltransf_4" amino acids 2 to 152 (151 residues), 61.8 bits, see alignment E=1.6e-20 PF13673: Acetyltransf_10" amino acids 23 to 137 (115 residues), 28.9 bits, see alignment E=2e-10 PF00583: Acetyltransf_1" amino acids 40 to 134 (95 residues), 49.4 bits, see alignment E=1.1e-16 PF13508: Acetyltransf_7" amino acids 51 to 134 (84 residues), 27.6 bits, see alignment E=6.3e-10

Best Hits

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 50% identity to hoh:Hoch_4405)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DKK6 at UniProt or InterPro

Protein Sequence (186 amino acids)

>ABZR86_RS08625 GNAT family N-acetyltransferase (Dyella japonica UNC79MFTsu3.2)
MIRIAVPADAAAIHAIYTPHVLQGMATFETELPGEAAMRERIAGRLPHYPWIVWEEHGRL
LAYAYASRFRERAAYDWIAETSIYVHEDAQRRGIARRLYGVLLDGMRLQGINQAVGVITM
PGEASVAMHETMGFAPAGIWRKAGYKLGQWWDVGVWQKELQAPAVPPTAVIPFAQLRDRA
EWQALL