Protein Info for ABZR86_RS08595 in Dyella japonica UNC79MFTsu3.2

Annotation: GntP family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 99 to 127 (29 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 316 to 341 (26 residues), see Phobius details amino acids 361 to 385 (25 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 76% identity to dar:Daro_0456)

Predicted SEED Role

"D-beta-hydroxybutyrate permease" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DLT9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>ABZR86_RS08595 GntP family permease (Dyella japonica UNC79MFTsu3.2)
MSFAIVLAALCFLMLAAYRGYSVILFAPLAALGAVLLTDPALVAPMFTGLFMDRMVGFLK
LYFPVFMLGAVFGKLIEMSGFSKAIVAGTIGLVGRGRAMLSIVLVCALLTYGGVSLFVVV
FAVYPFAAELFRQADIPKRLIPGTIALGAFTFTMDALPGTPQIQNIIPTSFFGTTAWAAP
WLGTLGAVFILSVGLAYLESRRRRAAAAGEGYGEVLANEPAPFEGARLAHPLVALLPLVV
VGVANKLLADALPRLYGATQSFVPAVIGEAKPVVQEVSKLAAIWAVEGALLLGIACVLLF
AWKPVQRSFAEGSKAAVAGALLASMNTASEYGFGAVIAALPGFKLIAEGLHAIPNPLVNQ
AVSITALAGITGSASGGMGIALAAMADTFIRNAQAAGIPMEVLHRVAAMASGGMDTLPHN
GAVITLLAVTGLTHRQSYRDIFAITLIKTAAVFVAIGGYYLLGLV