Protein Info for ABZR86_RS08485 in Dyella japonica UNC79MFTsu3.2

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF00375: SDF" amino acids 7 to 427 (421 residues), 343.7 bits, see alignment E=7.6e-107

Best Hits

KEGG orthology group: None (inferred from 66% identity to ote:Oter_0383)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DNW4 at UniProt or InterPro

Protein Sequence (438 amino acids)

>ABZR86_RS08485 dicarboxylate/amino acid:cation symporter (Dyella japonica UNC79MFTsu3.2)
MSTPNRLATRILQGLLIGVVAAIATLAIGQFHPATLKTMQAFATAVLDPLGQVFLRLLFF
VVIPLVFASLASGVAQLGRLGRLGPLAARTFALFAANMLIAVAIGLLMMNLLQPGHQLEP
GSRERLLQEYGGGAHRAMERRQQQPDMSLATAVDMFMPRNLLGAFVGHDRGALGDVLPLI
LFAILVGAAATLLDEDKRLKLQSGLDLLSELMTGIVGFALRLAPVAVPAMIYSVIVKIGT
GVLLTLSVFTAGCALALALHLFGSLSLWLRLLARRSPLAYFRQIRPVLITAFSTSSSSAT
LPASLALARDELRLRPSTAGFVLPLGATMNMSGTALFEGCVVLFVAQAFGVDLTLGQQCV
LMLLAVLSAVAVAGIPGGSLPLIAGLLATFGVPPEGIGLVLGVDRILDMLRTTVNVGSDL
VTATVVDAGAVRGDHADA