Protein Info for ABZR86_RS08430 in Dyella japonica UNC79MFTsu3.2

Annotation: 2-methylaconitate cis-trans isomerase PrpF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 324 to 339 (16 residues), see Phobius details TIGR02334: probable AcnD-accessory protein PrpF" amino acids 10 to 398 (389 residues), 752.5 bits, see alignment E=4e-231 PF04303: PrpF" amino acids 11 to 397 (387 residues), 644 bits, see alignment E=3.7e-198

Best Hits

Swiss-Prot: 83% identical to PRPF_CUPNE: 2-methyl-aconitate isomerase from Cupriavidus necator

KEGG orthology group: K09788, hypothetical protein (inferred from 89% identity to bpd:BURPS668_A0385)

Predicted SEED Role

"2-methylaconitate cis-trans isomerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DQ00 at UniProt or InterPro

Protein Sequence (399 amino acids)

>ABZR86_RS08430 2-methylaconitate cis-trans isomerase PrpF (Dyella japonica UNC79MFTsu3.2)
MTNAIKAHAPQLRIPATYLRGGTSKGVFFRLQDLPAAAQVPGAARDALLQRVIGSPDPYG
KQIDGMGGATSSTSKTVIVSRSSRADHDVDYLFGQVAIDKAFVDWSGNCGNLSAAVGPFA
IANGLVDPARVPRDGIAIVRIWQANIGKTIIARVPITDGAVQETGDFELDGVTFPAAEVQ
LEFVDPAAEEDGAGGAMFPTGHVVDDLEVPGVGTLKATMINAGIPTIFVEAAAIGYTGTE
LQDAINSDAKALAMFETIRAHGALRMGLIATLEEIATRQHTPKVAFVAGPADYLASSGKR
VAAGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIPGTLVNVAAGGGERHAVRFGHPSG
TLRVGAEAAQVDGAWTVTKAVMSRSARVLMEGWVRVPAG