Protein Info for ABZR86_RS08355 in Dyella japonica UNC79MFTsu3.2

Annotation: FtsH protease activity modulator HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 41 to 66 (26 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 43 (43 residues), 41.8 bits, see alignment 8.2e-15 PF01145: Band_7" amino acids 66 to 274 (209 residues), 104.1 bits, see alignment E=9.2e-34 TIGR01933: HflK protein" amino acids 209 to 359 (151 residues), 174.6 bits, see alignment E=1.3e-55

Best Hits

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DQJ3 at UniProt or InterPro

Protein Sequence (383 amino acids)

>ABZR86_RS08355 FtsH protease activity modulator HflK (Dyella japonica UNC79MFTsu3.2)
MAWNEPGNGQRDPWGKPRQTPGKSGLDDAFKQLKNRLSRLGGGPGGLLTIVLALLLASLL
LSSATVVDARQAGVVLRFGQYARTLGPGFHFKLPRPFETVTKVSTTEVRSVSDKVRMLTS
DENIISVDFNVQYQVSDARKFLFSLSGQPEDTLRQAAEAAVRSVVGANVMDNILTSSAAE
QVAVPATPTTTAAPVAAAQAAVNQASAAAQARDTLQQQTREILQATLDSYDSGLAVTDVS
FQNVSPPQEVKDAFDDVNAAREDKQGTENNARAYASKVVPEARGEASRIAAQAQGYSAER
VARATGDADRFNLILKEYRGAPEVTRRRLWLETVEDVMSNNPKVLDGTGGRNMIYLPLDR
AAVRDLPGVGTVAPAADSGKEKQ