Protein Info for ABZR86_RS08235 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 79 to 108 (30 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 25 to 331 (307 residues), 307.2 bits, see alignment E=5e-96 PF00528: BPD_transp_1" amino acids 105 to 332 (228 residues), 66 bits, see alignment E=2e-22

Best Hits

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DSH6 at UniProt or InterPro

Protein Sequence (338 amino acids)

>ABZR86_RS08235 phosphate ABC transporter permease subunit PstC (Dyella japonica UNC79MFTsu3.2)
MQANEAAAAVPIQEVRAHRDARDDRLFGWLLKGCALLVLASLLGAAGATLWGGRDAFMHF
GFGFLTSSEWNPSDDVYGALVPVFGTLITSFIALFIAVPVSFGIALYLSEVAPPWLRTPV
SSAIELLAGIPSIIYGMWGLFVFAPFFADHVKPWLTSYLGNQPDDGKVSWVAEHIPFIGR
MFGNDNPFGGSVLTAGIVLAIMIIPFISSVMREVFQTVPTRLKESAYALGSSTWEVVWDI
VLPYTRSAVIGGIFLGLGRALGETMAVTFIIGNKMKLSPSLLDPGASIASTIANQFGEAA
GLQKSALMALAFLLFVVTFIVLMIARLMLRRLAHKEGR