Protein Info for ABZR86_RS08225 in Dyella japonica UNC79MFTsu3.2

Annotation: ribonuclease T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR01298: ribonuclease T" amino acids 15 to 212 (198 residues), 325.7 bits, see alignment E=5.3e-102 PF00929: RNase_T" amino acids 25 to 199 (175 residues), 90.1 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 63% identical to RNT_PSEAE: Ribonuclease T (rnt) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03683, ribonuclease T [EC: 3.1.13.-] (inferred from 62% identity to aeh:Mlg_2268)

MetaCyc: 60% identical to ribonuclease T (Escherichia coli K-12 substr. MG1655)
Ribonuclease D. [EC: 3.1.13.5]; 3.1.13.5 [EC: 3.1.13.5]; 3.1.13.- [EC: 3.1.13.5]

Predicted SEED Role

"Ribonuclease T (EC 3.1.13.-)" in subsystem tRNA processing (EC 3.1.13.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.1.13.5

Use Curated BLAST to search for 3.1.13.- or 3.1.13.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DSB3 at UniProt or InterPro

Protein Sequence (222 amino acids)

>ABZR86_RS08225 ribonuclease T (Dyella japonica UNC79MFTsu3.2)
MDKPENLSNSMSNRLADRFRGFLPVIVDVETGGFDAERDALLEIAAVTLDMDAEGYLRPR
PAVSAHVEPFPGANIDPRALEITGIDPDNPLRGALHERAALDHIFKEVRERMRDADCQRA
ILVGHNAAFDLGFLNAAVRRVGHKRNPFHPFSCFDTATLGGLAYGQTVLSKSVQAAGFLF
DTREAHSAIYDADRTAELFCTIVNRWRRLETFEREHIGLDVL