Protein Info for ABZR86_RS08180 in Dyella japonica UNC79MFTsu3.2

Annotation: RnfABCDGE type electron transport complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 4 to 141 (138 residues), 215 bits, see alignment E=3.4e-68 PF04060: FeS" amino acids 14 to 46 (33 residues), 55.7 bits, see alignment 1.1e-18 PF14697: Fer4_21" amino acids 79 to 133 (55 residues), 62.3 bits, see alignment E=1.3e-20 PF00037: Fer4" amino acids 81 to 101 (21 residues), 26 bits, see alignment (E = 2.1e-09) amino acids 111 to 131 (21 residues), 27 bits, see alignment (E = 1e-09) PF13237: Fer4_10" amino acids 81 to 127 (47 residues), 26.2 bits, see alignment 2.3e-09 PF13187: Fer4_9" amino acids 86 to 131 (46 residues), 29.1 bits, see alignment 2.9e-10 PF12838: Fer4_7" amino acids 86 to 130 (45 residues), 29 bits, see alignment 4.4e-10

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 51% identity to bbr:BB3784)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DTC7 at UniProt or InterPro

Protein Sequence (204 amino acids)

>ABZR86_RS08180 RnfABCDGE type electron transport complex subunit B (Dyella japonica UNC79MFTsu3.2)
MASSSLADRIDALLPQTQCEQCGFHGCRPYAEAIARGEAQINQCPPGGAAGIRKLAELLG
CEPLPLNPDNGVEKPRMLARIVEADCIGCTKCIQVCPVDAIVGGAKLMHSVIEDDCTGCE
LCVPACPVDCIALEPMPLEQVDDPACADRGRAHFQRREARLAREHARHDAELAARKAQLG
AAVSDNPVLAALARAKARQQEPKP