Protein Info for ABZR86_RS08160 in Dyella japonica UNC79MFTsu3.2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 314 (304 residues), 82.4 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 49% identical to Y1221_YERPE: Uncharacterized MFS-type transporter YPO1221/y2967/YP_0917 (YPO1221) from Yersinia pestis

KEGG orthology group: None (inferred from 52% identity to yep:YE105_C2720)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DUG2 at UniProt or InterPro

Protein Sequence (372 amino acids)

>ABZR86_RS08160 MFS transporter (Dyella japonica UNC79MFTsu3.2)
MGRATLSTRLIFLVSGIGMSAWAPMVPYAKSRLGLDDAQLGLILLVFGGGSMASMPFVGW
LTHRFGNRRVIVASGLLLCLALPALALAPSALLLTAALAYFGVMLGVVDVAMNAHAVEVE
KLDGRVLMSGFHGLFSVGGLTGAALMSALLAIGLPLAWSAAVLAGLLAALVLFLRGGLLA
GASEAEGHAAFGIPRGLVLLLGLLCFVSFMAEGSMLDWSAVFLRDFRGFAASSAGIGYAC
FSIAMALGRLTGDRLVQRVGTVWTVRAGAALAAAGFALVSSVPWAPLSLLGFVLIGLGAS
NIVPVMFSAAGRLPGTSPAVALATVTMLGYVGLLSGPALIGFLSKITSLPLAMAAVAVLL
AVVSASARIVRR