Protein Info for ABZR86_RS08130 in Dyella japonica UNC79MFTsu3.2

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 4 to 187 (184 residues), 165 bits, E=7.5e-53
• PF00692: dUTPase
  • amino acids 80 to 184 (105 residues), 30 bits, E=1.9e-11

Best Hits

Swiss-Prot: 88% identical to DCD_THISH: dCTP deaminase (dcd) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 87% identity to slt:Slit_2543)

MetaCyc: 69% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See A0A1I2DUJ0 at UniProt or InterPro

Protein Sequence (188 amino acids)

>ABZR86_RS08130 dCTP deaminase (Dyella japonica UNC79MFTsu3.2)
MSIKSDKWIRRMADQHGMIEPYEPGQIKLRDGNKLVSYGTSSYGYDVRCAREFKIFTNIN
STIVDPKAFDPTSFVDVEADVCIIPPNSFALARTVEYFRIPRSVLTICLGKSTYARCGII
VNVTPLEPEWEGHVTLEFSNTTPLPAKIYANEGVAQMLFLESDEECETSYRDRGGKYQGQ
RGVTLPRT