Protein Info for ABZR86_RS08115 in Dyella japonica UNC79MFTsu3.2

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF01738: DLH" amino acids 15 to 217 (203 residues), 134.9 bits, see alignment E=1.6e-43

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 59% identity to smt:Smal_2866)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DW26 at UniProt or InterPro

Protein Sequence (222 amino acids)

>ABZR86_RS08115 dienelactone hydrolase family protein (Dyella japonica UNC79MFTsu3.2)
MGQHINLPTSGTQCIGAYLARPEGKPKGGIVVIQEIFGVNAHIRSVADRLAAAGYVAVAP
QFFDYLETGVEMDYNADTSARGKALVNELGMDRAVEAVGSAAESIASAGKIGTVGFCWGG
TVALLAAIRLGLPSVSYYGARNLPFLDEALKAPVMFHFGELDKSIPPEMVAKHREKLPQM
EIYTYPADHAFNRDVGAQYHEPSATLAWDRSMGFFARELAGA