Protein Info for ABZR86_RS08050 in Dyella japonica UNC79MFTsu3.2

Annotation: 50S ribosomal protein L3 N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 5 to 287 (283 residues), 390.9 bits, see alignment E=3.3e-121 TIGR00536: methyltransferase, HemK family" amino acids 7 to 293 (287 residues), 240.5 bits, see alignment E=2e-75 PF05175: MTS" amino acids 121 to 208 (88 residues), 64.5 bits, see alignment E=2.8e-21 PF06325: PrmA" amino acids 124 to 200 (77 residues), 27 bits, see alignment E=9e-10 PF05971: Methyltransf_10" amino acids 126 to 210 (85 residues), 25.1 bits, see alignment E=3.4e-09 PF13847: Methyltransf_31" amino acids 127 to 257 (131 residues), 31.8 bits, see alignment E=3.4e-11 PF08242: Methyltransf_12" amino acids 130 to 200 (71 residues), 30.2 bits, see alignment E=1.8e-10 PF13649: Methyltransf_25" amino acids 130 to 206 (77 residues), 31 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 66% identical to PRMB_XANCP: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 67% identity to xcv:XCV2878)

MetaCyc: 52% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DVY8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>ABZR86_RS08050 50S ribosomal protein L3 N(5)-glutamine methyltransferase (Dyella japonica UNC79MFTsu3.2)
MTAELASIIDFIRYGASRFSAAGLTFGHSHDNPIDEATHLVLASLHLPPDIPPAYGAGKL
TAEERERVLGLIERRIAERLPVAYLVGETWFAGLKFKSDRRALVPRSPIAELIESGFQPW
LEHRQVERALDLCTGSGCIGIAMAEYNPDWQVDIVDISDEALSLARENIVFQHVERRVEA
VRSDLFNGLKGRRYDLIVSNPPYVTEAEYAALPGEYSHEPKLGLTSGEDGLDLCLRMLDE
AADYLSEDGLLIVEVGESEHALVELLPEVPFVWIEFKVGAMGVFALERRDLLAHADAIRA
AARARHG