Protein Info for ABZR86_RS08030 in Dyella japonica UNC79MFTsu3.2

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01118: Semialdhyde_dh" amino acids 8 to 121 (114 residues), 119.5 bits, see alignment E=1.2e-38 TIGR01296: aspartate-semialdehyde dehydrogenase" amino acids 8 to 339 (332 residues), 457.8 bits, see alignment E=1.1e-141 PF02774: Semialdhyde_dhC" amino acids 143 to 324 (182 residues), 209.2 bits, see alignment E=5.9e-66

Best Hits

Swiss-Prot: 63% identical to DHAS_LEGPN: Aspartate-semialdehyde dehydrogenase (asd) from Legionella pneumophila

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 76% identity to xop:PXO_01262)

MetaCyc: 52% identical to aspartate semialdehyde dehydrogenase subunit (Bacillus subtilis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DXE8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>ABZR86_RS08030 aspartate-semialdehyde dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MSKKSSYKVAMVGATGAVGETLLAILAERKFPVGELVPLASERSAGGKVDFAGKSVTVRN
LADYDFTGVDIAFFSAGGSVSREHAPRAAAAGAVVIDNTSEFRYQDDIPLVVSEVNPHAI
ARYTVRGIIANPNCSTMQMLVALAPIHRQAGIERINVATYQSVSGAGRSGMEELGKQTAA
LLNFQDVERSKFPKQIAFNVIPHIDDFQDNGYTKEEMKMVWETRKILEDETIQVNPTAVR
VPVFYGHSEAVHIETRDKITAGQARALLEKAEGVVVQDERKAGGYPTPVGDAAGKDPVFV
GRIREDISHERGLDLWIVSDNIRKGAALNAVQIAERLIEDYL