Protein Info for ABZR86_RS08030 in Dyella japonica UNC79MFTsu3.2

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01296: aspartate-semialdehyde dehydrogenase
  • amino acids 8 to 339 (332 residues), 457.8 bits, E=1.1e-141
• PF01118: Semialdhyde_dh
  • amino acids 8 to 121 (114 residues), 119.5 bits, E=1.2e-38
• PF02774: Semialdhyde_dhC
  • amino acids 143 to 324 (182 residues), 209.2 bits, E=5.9e-66

Best Hits

Swiss-Prot: 63% identical to DHAS_LEGPN: Aspartate-semialdehyde dehydrogenase (asd) from Legionella pneumophila

KEGG orthology group: K00133, aspartate-semialdehyde dehydrogenase [EC: 1.2.1.11] (inferred from 76% identity to xop:PXO_01262)

MetaCyc: 52% identical to aspartate semialdehyde dehydrogenase subunit (Bacillus subtilis)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• aspartate superpathway (21/25 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• L-methionine biosynthesis IV (2/4 steps found)
• spermidine biosynthesis II (2/4 steps found)
• ectoine biosynthesis (2/5 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
• norspermidine biosynthesis (2/6 steps found)
• cremeomycin biosynthesis (2/7 steps found)
• grixazone biosynthesis (2/8 steps found)
• superpathway of polyamine biosynthesis III (2/8 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

See A0A1I2DXE8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>ABZR86_RS08030 aspartate-semialdehyde dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MSKKSSYKVAMVGATGAVGETLLAILAERKFPVGELVPLASERSAGGKVDFAGKSVTVRN
LADYDFTGVDIAFFSAGGSVSREHAPRAAAAGAVVIDNTSEFRYQDDIPLVVSEVNPHAI
ARYTVRGIIANPNCSTMQMLVALAPIHRQAGIERINVATYQSVSGAGRSGMEELGKQTAA
LLNFQDVERSKFPKQIAFNVIPHIDDFQDNGYTKEEMKMVWETRKILEDETIQVNPTAVR
VPVFYGHSEAVHIETRDKITAGQARALLEKAEGVVVQDERKAGGYPTPVGDAAGKDPVFV
GRIREDISHERGLDLWIVSDNIRKGAALNAVQIAERLIEDYL