Protein Info for ABZR86_RS07995 in Dyella japonica UNC79MFTsu3.2

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00290: Trp_syntA" amino acids 8 to 258 (251 residues), 270.9 bits, see alignment E=4.1e-85 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 257 (250 residues), 228.9 bits, see alignment E=2.3e-72

Best Hits

Swiss-Prot: 59% identical to TRPA_CHRSD: Tryptophan synthase alpha chain (trpA) from Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 59% identity to csa:Csal_1262)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DW13 at UniProt or InterPro

Protein Sequence (266 amino acids)

>ABZR86_RS07995 tryptophan synthase subunit alpha (Dyella japonica UNC79MFTsu3.2)
MNRIDRRFDTLKSNRRTGLIPFVTAGDPAPEHTVALMHALVDAGADVIELGVPFSDPMAD
GPVIQHASERAIAKGVGLADVLGWVSTFRQRDADTPVVLMGYLNPVEIRGYERFAAEAVE
AGVDGVLLVDCPLEESAVLAPLKAAGLRQILLAAPTTAPARMAQLCGAAEGFLYYVSFAG
ITGAGRLSTSDIAARVAGIRSRAKAPVAVGFGVRDAQSARDIAGFADAVVIGSALVERLA
GAERADEIADRAKAFLQPIRTALDAR