Protein Info for ABZR86_RS07930 in Dyella japonica UNC79MFTsu3.2

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 38 to 63 (26 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details PF01569: PAP2" amino acids 73 to 183 (111 residues), 70.3 bits, see alignment E=1.4e-23 PF14378: PAP2_3" amino acids 116 to 174 (59 residues), 31.2 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: None (inferred from 65% identity to xca:xccb100_3393)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DXZ8 at UniProt or InterPro

Protein Sequence (190 amino acids)

>ABZR86_RS07930 phosphatase PAP2 family protein (Dyella japonica UNC79MFTsu3.2)
MNTLPPLHTPELTTGPRFAIDRRICVAANHWGARRAVGVFFGIVSRLGDGVFWYSLMLAL
AVFDGRRGLAAAAQMAITGLTALLLYRLLKRWTRRPRPFRACPGVIAHVPPLDEFSFPSG
HTLQAVSFTIVALAWYPLLAPLLLTFTALIGASRVILGLHYPSDVIAATAIGGALGSLSL
WLLPLAHWMH