Protein Info for ABZR86_RS07910 in Dyella japonica UNC79MFTsu3.2

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR00464: glutamate--tRNA ligase" amino acids 2 to 462 (461 residues), 575.2 bits, see alignment E=5.9e-177 PF00749: tRNA-synt_1c" amino acids 3 to 305 (303 residues), 341.8 bits, see alignment E=3.2e-106 PF19269: Anticodon_2" amino acids 341 to 461 (121 residues), 110 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 69% identical to SYE_XANAC: Glutamate--tRNA ligase (gltX) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 69% identity to xac:XAC2847)

MetaCyc: 61% identical to glutamate--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--tRNA ligase. [EC: 6.1.1.17]

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DXK8 at UniProt or InterPro

Protein Sequence (466 amino acids)

>ABZR86_RS07910 glutamate--tRNA ligase (Dyella japonica UNC79MFTsu3.2)
MTVRTRFAPSPTGFLHIGGARTALYCWLEARRRGGQFVLRIEDTDRERSTQEAVQAILDG
MSWLGLVHDEGPVYQTHRLDRYKQVADELLKAGKAYYAYESKEEIEAMREAAMARGEKPR
YNGYYRDRNESFREDPNRVIRFKNPLEGSVVFDDKVKGRVEWANAELDDLVIFRSDGWPT
YNFAVVVDDIDMGITEVIRGDDHVNNTPRQINIYKALDKPVPEFAHLPMILGPDGQKLSK
RHGAVSVMQYRDDGFLPHALLNYLVRLGWSHGDQEIFSPQEMIELFDIGDVNKAASRFDV
TKLSWLNQHYLKTDEPQAIAPEFEYQLQLAGIDYSKGPLPADVIVALRDRVQTLKEMAER
AKIWYGPIVEWDDKAVAKHLQNDGAVAVLEEAKALFAACEWTPEAIHQAVEQIAARLELG
MGKIAQPLRVAMTGTQVSPSIDHTVYLAGREEALKRIDDAIARARG