Protein Info for ABZR86_RS07885 in Dyella japonica UNC79MFTsu3.2

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 37 to 311 (275 residues), 275.2 bits, see alignment E=2.9e-86 PF01545: Cation_efflux" amino acids 40 to 231 (192 residues), 160.3 bits, see alignment E=2.6e-51

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 52% identity to ajs:Ajs_1370)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2DYW9 at UniProt or InterPro

Protein Sequence (327 amino acids)

>ABZR86_RS07885 cation diffusion facilitator family transporter (Dyella japonica UNC79MFTsu3.2)
MSHSHAHSHHDGDRHGHAHEHGAHDHAHAGAGMSGRERKLLVAFVLTALMMVAEAVGGLW
SGSLALLADAGHMLVDALALLLAVLGAWMARRPADARRSYGYGRVEVLAGFLNALTQFAL
VAFIAYEAIERLFTPTPILSGVMFIVALAGLLVNVAVLRTLHGHDHDDVNVAGAALHVLG
DLLGSVAAVLAALAVRWLGWLWADPVLSLLVSLLILNSAWRLLRRSAHILLEGVPEGLDT
GEIELALREADASISDVHHLHVWQLASGSRMATVHAQLRDDSHGATAIAAINRVLGERFG
IRHVTVQIDSGHCPDHAQGCASGRRSD