Protein Info for ABZR86_RS07745 in Dyella japonica UNC79MFTsu3.2

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 906 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 233 to 314 (82 residues), 35 bits, see alignment E=1.4e-12 amino acids 352 to 458 (107 residues), 49.4 bits, see alignment E=4.9e-17 PF00989: PAS" amino acids 235 to 286 (52 residues), 30.8 bits, see alignment 9e-11 amino acids 348 to 453 (106 residues), 35.1 bits, see alignment E=4e-12 PF13188: PAS_8" amino acids 235 to 289 (55 residues), 31.9 bits, see alignment 3.1e-11 PF13426: PAS_9" amino acids 248 to 291 (44 residues), 25.3 bits, see alignment 5.2e-09 amino acids 353 to 455 (103 residues), 50.1 bits, see alignment E=1e-16 PF08448: PAS_4" amino acids 352 to 455 (104 residues), 31.3 bits, see alignment E=7.1e-11 PF08447: PAS_3" amino acids 365 to 449 (85 residues), 28.5 bits, see alignment E=5.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 463 to 626 (164 residues), 127.7 bits, see alignment E=3.7e-41 PF00990: GGDEF" amino acids 467 to 623 (157 residues), 133.7 bits, see alignment E=1.9e-42 PF00563: EAL" amino acids 645 to 879 (235 residues), 257.4 bits, see alignment E=4.1e-80

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2E1N4 at UniProt or InterPro

Protein Sequence (906 amino acids)

>ABZR86_RS07745 EAL domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MRRPLLQRLLPLAYALAAMLGLVLALTWGALQLQVTLAGFLNGESLWSKAQKQAVVDLEN
YATKGAPADLRGFRSNYAVLMTDRYARDKIDSGDFDRAEVIEAFRRGGVIPSAIPGMVFI
LQYFSAAPHMREALADWHSVDGQIAELNDIAGELERGYAAGALAPAEIARQRERIRKLND
FIEPRSSSFSLHIANGATWMGRVLFASVALITLVAGLSWLRMARRILAGIRGTEERYRLL
FDSAASAIVMVDESSGQILDANRTAARWTGRDPDQLLGESFARLFASAEAPQDGNVSLLR
DAGGEARPVETQSALALWGERFVRQAIISDVSERLSMEHERRIASEALAGIAEGVVIADA
ERRITTVNTAFTRITGYDADAVRTRRFDETRSLADGSPLPASIWDTVANGGNWKGEVSSR
RQDGSSYPELLSISAIRDTYGRVQHYVAVLTDITAIKADRLRLEHLATHDPLTGLVNRAE
FERLCEHAILGATHDRNAVAVLFVDLDAFKVVNDSYSHAIGDSLLVKVAERIDRALGPHD
VAGRIGGDEFTVLLGRLPTREDARGMATRLLSSLAEPVMVGDYEIALSASIGIAGFPLDG
GDPITLITNADAAMYVAKTEERNAFRFYTPLMHADARRRLMLGVDLRQALVRGELYQVYQ
PNVELRTGRIVAVEALLRWRHPERGVLLPDEFIPMAESLGLIRQIDEWVMREACAQVRRW
DDAHLPPLRMAINVSASTFGHRTFIERLSAALDAEQLDGKRLLVEITESAILRLGEQTDR
TMHALHALGVGVAIDDFGTGYSSLAYLKLSAIAFLKIDRSFINGLPQDSNNAAITEAMLA
IARSLGLRPIAEGIETKEQHEFLLKAGCAEGQGFYYSRPEAADEIARQLVRSPKPAKLRL
VPPKRS