Protein Info for ABZR86_RS07740 in Dyella japonica UNC79MFTsu3.2

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 50 to 198 (149 residues), 168.3 bits, see alignment E=8.1e-54 PF01625: PMSR" amino acids 51 to 199 (149 residues), 195.2 bits, see alignment E=4e-62

Best Hits

Swiss-Prot: 63% identical to MSRA2_RHILO: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 59% identity to rlt:Rleg2_6004)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2E0X8 at UniProt or InterPro

Protein Sequence (234 amino acids)

>ABZR86_RS07740 peptide-methionine (S)-S-oxide reductase MsrA (Dyella japonica UNC79MFTsu3.2)
MTTRLPRLRLLAGLMLAAGTTACGVVAADSAPVAAPAPAIDAAPAQGDQVAVFAGGCFWG
VESVFEHVKGVKKVWSGYAGGNADTADYETVSGGRSGHAESVKIVYDPAKVSYGKLLQVF
FSVAADPTQLNRQGPDVGTQYRSVIFYGNDEQKRVAGAYIAQLDQAHVFRAPIVTQLVPL
KAFYMAEAYHQDFARLHPDYPYIVINDAPKVRHLKELFPAEYKPEESVVDVRLH