Protein Info for ABZR86_RS07610 in Dyella japonica UNC79MFTsu3.2

Annotation: cytochrome o ubiquinol oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 32 to 127 (96 residues), 115 bits, see alignment E=8.8e-38 PF03626: COX4_pro" amino acids 38 to 111 (74 residues), 62.8 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 68% identity to vpe:Varpa_4714)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FUE3 at UniProt or InterPro

Protein Sequence (137 amino acids)

>ABZR86_RS07610 cytochrome o ubiquinol oxidase subunit IV (Dyella japonica UNC79MFTsu3.2)
MSAHTDVHAAHDGHDHHHDPHDEHHDDGIGHVSLKGYMIGFVLAVLLTAVPFALVMSGGL
KDSGTTALVILGFAAVQIVVHMVYFLHMNAKSEGGWNMLALIFTAVLVLITLSGSIWVMY
HLNHNMMPALMDPRNLP