Protein Info for ABZR86_RS07585 in Dyella japonica UNC79MFTsu3.2

Annotation: homocysteine S-methyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02574: S-methyl_trans
  • amino acids 24 to 344 (321 residues), 327.6 bits, E=4.9e-102

Best Hits

KEGG orthology group: K00548, 5-methyltetrahydrofolate--homocysteine methyltransferase [EC: 2.1.1.13] (inferred from 75% identity to psu:Psesu_1798)

Predicted SEED Role

"5-methyltetrahydrofolate--homocysteine methyltransferase (EC 2.1.1.13)" in subsystem Methionine Biosynthesis (EC 2.1.1.13)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• aspartate superpathway (21/25 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• L-methionine biosynthesis III (3/4 steps found)
• L-methionine biosynthesis I (3/5 steps found)
• L-methionine salvage from L-homocysteine (1/3 steps found)
• folate transformations I (8/13 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.13

Use Curated BLAST to search for 2.1.1.13

Sequence Analysis Tools

See A0A1I2FST3 at UniProt or InterPro

Protein Sequence (361 amino acids)

>ABZR86_RS07585 homocysteine S-methyltransferase family protein (Dyella japonica UNC79MFTsu3.2)
MSALPWLHPDRVALLEAALRERILILDGGMGTMLQGHRLEEEGFRGERFVEGRDHAHEAH
HDHPGCDLKGNNDLLTLTQPAIIRGVHEAYLEAGADLVETNTFNSTRISQADYHLEHLAH
ELNLEGARLARAACDAWTAKTPEQPRFVIGVLGPTSRTASLSPDVNDPGFRNVTFEELAA
NYTEAAAGLVDGGADLIMVETIFDTLNAKAALFAISELFRERGARLPVMISGTITDRSGR
TLSGQTAEAFYYSVAHARPLSVGLNCALGAADLRPHVQTLAQVAGCFVSTHPNAGLPNAF
GEYDETPEQMAAVIGGFARDGLLNLVGGCCGTTPAHIKAIAEAVRDCAPRALPSLDDAEA
A