Protein Info for ABZR86_RS07580 in Dyella japonica UNC79MFTsu3.2

Annotation: metalloregulator ArsR/SmtB family transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF12840: HTH_20" amino acids 13 to 61 (49 residues), 42.5 bits, see alignment 2.7e-14 PF01022: HTH_5" amino acids 15 to 60 (46 residues), 54.6 bits, see alignment 4.3e-18 PF12802: MarR_2" amino acids 16 to 62 (47 residues), 31.4 bits, see alignment 9.7e-11 PF01209: Ubie_methyltran" amino acids 132 to 260 (129 residues), 29.9 bits, see alignment E=2e-10 PF13489: Methyltransf_23" amino acids 137 to 255 (119 residues), 51.9 bits, see alignment E=4.2e-17 PF13847: Methyltransf_31" amino acids 149 to 247 (99 residues), 48.8 bits, see alignment E=3.6e-16 PF13649: Methyltransf_25" amino acids 150 to 241 (92 residues), 64.9 bits, see alignment E=4.9e-21 PF08241: Methyltransf_11" amino acids 151 to 244 (94 residues), 71.8 bits, see alignment E=3.4e-23 PF08242: Methyltransf_12" amino acids 151 to 243 (93 residues), 55.5 bits, see alignment E=4.3e-18

Best Hits

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 63% identity to smt:Smal_2610)

Predicted SEED Role

"Transcriptional regulator, ArsR family / Methyltransferase fusion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FUM8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>ABZR86_RS07580 metalloregulator ArsR/SmtB family transcription factor (Dyella japonica UNC79MFTsu3.2)
MDLATASSVLRLLADPTRVRLLALLEREELTVAELAAVLRLAQPRVSTHLAKLKEAELVR
DRRAGVSAYYRANREGDERQHDLIRSLRDSIDDALLREDAARLPAVLAQRASEAGWADTV
AGDMERHYSPGRTWETLARSLLQLLETGDVLDIASGDGITAELLAPHARSIVCVDSSERV
AEAAAQRLQPFAHVEVRQGDMHALELGERRFDLVLMLHALTYAEQPAKAVAEASRLLRPG
GRLLAVTLGKHDHRAVVEPFDHRNLGFAQEELSGYARRAGLEDISCTRLSRERKAPHFEV
ISLLARKP