Protein Info for ABZR86_RS07575 in Dyella japonica UNC79MFTsu3.2

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 118 (113 residues), 129 bits, E=2.2e-41
• PF02770: Acyl-CoA_dh_M
  • amino acids 122 to 217 (96 residues), 92.5 bits, E=3e-30
• PF00441: Acyl-CoA_dh_1
  • amino acids 230 to 381 (152 residues), 171.3 bits, E=3.2e-54
• PF08028: Acyl-CoA_dh_2
  • amino acids 245 to 371 (127 residues), 93.3 bits, E=3.1e-30

Best Hits

Swiss-Prot: 50% identical to ACADS_BOVIN: Short-chain specific acyl-CoA dehydrogenase, mitochondrial (ACADS) from Bos taurus

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 78% identity to smt:Smal_2609)

MetaCyc: 50% identical to short-chain acyl-CoA dehydrogenase monomer (Homo sapiens)
BUTYRYL-COA-DEHYDROGENASE-RXN [EC: 1.3.8.1]; 1.3.8.1 [EC: 1.3.8.1]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• oleate β-oxidation (32/35 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (6/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• valproate β-oxidation (5/9 steps found)
• β-alanine biosynthesis II (2/6 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

See A0A1I2FSX9 at UniProt or InterPro

Protein Sequence (386 amino acids)

>ABZR86_RS07575 acyl-CoA dehydrogenase family protein (Dyella japonica UNC79MFTsu3.2)
MDFSFTEDQLSIQSIARDFAQKRIVPVAAELDAKGEFPLENIREMGQLGLMGIEVPHEYG
GAGMDPIAYVLAMIEIAAADAATSTVMSVNNSLFCNGILKHGNEEQKQKYVRAIAQGEAI
GAYALTEPQSGSDASAMHTRATKNADGDWVINGKKSWITSGPVARYIVLFAISTPGIGAR
GVSAFIIDTQLPGFAAGKTEPKLGIRASATCEIEFSDYVCPKENLLGEEGKGFSIAMGVL
DAGRIGIASQSVGIARAAYEATLQWSRDRKAFGQAIGSFQMTQAKIADMKCKLDAATLLT
LRAAWTKGQAEKNGGRFGTEASVAKLVASEAAMWIAHQAVQIHGGMGYSKEMPLERYFRD
AKITEIYEGTSEIQRLVIARAETGLR