Protein Info for ABZR86_RS07545 in Dyella japonica UNC79MFTsu3.2

Annotation: 5'-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06189: 5-nucleotidase
  • amino acids 16 to 308 (293 residues), 419.1 bits, E=3.6e-130

Best Hits

Swiss-Prot: 42% identical to 5NT1A_MOUSE: Cytosolic 5'-nucleotidase 1A (Nt5c1a) from Mus musculus

KEGG orthology group: K01081, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 72% identity to psu:Psesu_1459)

MetaCyc: 42% identical to cytosolic 5'-nucleotidase 1A subunit (Homo sapiens)
5'-nucleotidase. [EC: 3.1.3.5]

Predicted SEED Role

"5'-nucleotidase (EC 3.1.3.5)" in subsystem Purine conversions (EC 3.1.3.5)

MetaCyc Pathways

• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• guanosine nucleotides degradation III (1/4 steps found)
• NAD salvage (plants) (6/11 steps found)
• adenosine nucleotides degradation II (1/5 steps found)
• ureide biosynthesis (2/7 steps found)
• purine nucleotides degradation II (aerobic) (4/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

See A0A1I2FV42 at UniProt or InterPro

Protein Sequence (309 amino acids)

>ABZR86_RS07545 5'-nucleotidase (Dyella japonica UNC79MFTsu3.2)
MTTTLHDAHDPASAGDNRLVVAISSRALFDLGDSHALFERDGLDAYRAFQIDHENEILKP
GVAFPLVQKLLGLNKLAGDVPPVEVILLSRNSGDTGLRIFNAIQHYGLDISRAAFTSGAP
TSDYIAPFKTDLFLSANAEDVGRALAAGVAAATILPSVAPPRATEQLRIAFDGDAVLFGD
EGERVSREEGLEAFHRNERERAEESLSVGPFRGFLTAVHRLQAAFPAETSPIRTALVTAR
SAPAHKRVILTLRRWGVRIDEALFLGGRDKGPFLEAFGADIFFDDSPANVESARKYVAAG
HVPHGVSNS