Protein Info for ABZR86_RS07455 in Dyella japonica UNC79MFTsu3.2

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 16 to 339 (324 residues), 204 bits, E=1.5e-64
• PF01565: FAD_binding_4
  • amino acids 26 to 148 (123 residues), 66.5 bits, E=2.1e-22
• PF02873: MurB_C
  • amino acids 216 to 339 (124 residues), 91.3 bits, E=3.8e-30

Best Hits

Swiss-Prot: 51% identical to MURB_XYLF2: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Xylella fastidiosa (strain M23)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 55% identity to smt:Smal_1723)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• peptidoglycan recycling I (11/14 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See A0A1I2FWP3 at UniProt or InterPro

Protein Sequence (342 amino acids)

>ABZR86_RS07455 UDP-N-acetylmuramate dehydrogenase (Dyella japonica UNC79MFTsu3.2)
MGGYALIENAPLGQRNTLRVNARARLLAEVTDAAKLPELLDFPGVRSGPLLVLGEGSNLL
LADDLDGTVVAMANRGVHVEQEGELTRIAVAAGERWDDFVRWTLGQGFAGLENLILIPGT
VGAAPIQNIGAYGTEVAEFIESVEAWDTRERRVAVLDRADCAFAYRDSLFKREPGRYIVT
AVRFALPRTHGLRLDYAGIREELARMGVDKPAPFHVAEAVVHLRTRKLPDPAVIGNAGSF
FKNPVVDAAVGEALRRDYPELAAWPGADGRWKLSAAWLIEAAGFKGQREGDAGISNRHAL
VLVNHGQASGAQLWAFAQKVIAGVHGKFAVTLEPEPVVIGKG