Protein Info for ABZR86_RS07410 in Dyella japonica UNC79MFTsu3.2

Annotation: PepSY-associated TM helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 137 to 163 (27 residues), see Phobius details amino acids 187 to 215 (29 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 387 to 411 (25 residues), see Phobius details amino acids 418 to 437 (20 residues), see Phobius details amino acids 444 to 464 (21 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details PF03929: PepSY_TM" amino acids 11 to 367 (357 residues), 182.8 bits, see alignment E=7e-58

Best Hits

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FV78 at UniProt or InterPro

Protein Sequence (532 amino acids)

>ABZR86_RS07410 PepSY-associated TM helix domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MKSSTIRTFQTVHTWTGLLAGFALFIAFYAGALTVFHHDIALWQSPPWRSQAARDVSVQT
MIDCLLLQHPQAAKDFGIVLAPPGTSQGPYAYWNDGEEHFATADRLDRPTDDEGATRGNL
ADFVYALHDSLGIPVVGLYLMGIVSVIYGLALISGLLIHLPQLLGDLFALRPGRNLKRLW
QDAHNAIGVLSLPFHIIFAVTGALMCLFVPLFAALNLIAFDGKLGDAFARAISTAPTVQA
SGHAAPMLAAGELIERARTAALATGVTAFEPDYVHYDHYGDANALVQVRGVSQRTLGTYG
TIALNGATGAVLERHVGDTHSVNGLTNSSIYALHFGNFGGRAVQWLYFLLGLAGAFLFYS
GNLLWIESRRKRRHAAQPRKTWVMARATLGVCLGTCAGIAAAFAATMLAQAAGIDPAVPQ
QAACYGVVALAVAYACLRPVARAAVELLAVTALAYLAVAIADLMRNAHTWSQPWTPPSMA
VLGVDLTGIALGIGFAWLARASWKRAARGDANSVWAQAPAADALHVEAEDPR