Protein Info for ABZR86_RS07365 in Dyella japonica UNC79MFTsu3.2

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 26 to 39 (14 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 373 to 390 (18 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 449 to 472 (24 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 425 (396 residues), 173.7 bits, see alignment E=8.1e-55 PF05977: MFS_3" amino acids 51 to 205 (155 residues), 35.7 bits, see alignment E=5.5e-13 PF00083: Sugar_tr" amino acids 60 to 197 (138 residues), 31.6 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 64% identity to pna:Pnap_1660)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FYR8 at UniProt or InterPro

Protein Sequence (481 amino acids)

>ABZR86_RS07365 MFS transporter (Dyella japonica UNC79MFTsu3.2)
MSKPLVAANGESTTEAEAHLPATRWALAGLALSMLLPSLDTSIANTSLPILAKAFGASFQ
QVQWVVLAYLLAITTLIVGAGRLGDLMGRRRLLLVGISCFTFASALCGLSGNLWVLIVAR
AEQGLGAAIMLALTIAGVSEAVPQTRIGRAMGLLGTMSAIGTALGPAAGGILAATFGWPA
IFLVNVPLGIVAFLLVLRHMPKERPDAKPLHGGFDPLGTVLLALTLAAYALAMTLGRGEF
GALNIALLLGAVIGAGLFVHAEKRAASPLIRLAMLRDVNLSAGLAMSALVSAVMMTTLVV
GPFYLSRTLGLAPAWVGVVLSSGPCVTVLSSVPAGRLVDRFGAWRTTVLGLSGIAIGTSV
LSALTLAPSSFGVAGYVGPIVVTTLGYALFQASNNTAMMTGVASDRRGVVSGMLSLSRNL
GLVTGASAMAGLFAWAVGMSNAANADPTAVAFGVRVTFGVAAASMVLAIAIARRRSRRRL
G