Protein Info for ABZR86_RS07300 in Dyella japonica UNC79MFTsu3.2

Annotation: SurA N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF13624: SurA_N_3" amino acids 1 to 162 (162 residues), 151.4 bits, see alignment E=5.9e-48 PF13623: SurA_N_2" amino acids 2 to 139 (138 residues), 115.1 bits, see alignment E=7.8e-37 PF09312: SurA_N" amino acids 39 to 162 (124 residues), 35.6 bits, see alignment E=2.8e-12 PF13145: Rotamase_2" amino acids 245 to 379 (135 residues), 74.8 bits, see alignment E=3.1e-24 PF13616: Rotamase_3" amino acids 259 to 361 (103 residues), 80.5 bits, see alignment E=4.5e-26 PF00639: Rotamase" amino acids 271 to 363 (93 residues), 84.5 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: K03770, peptidyl-prolyl cis-trans isomerase D [EC: 5.2.1.8] (inferred from 36% identity to alv:Alvin_1428)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FWP9 at UniProt or InterPro

Protein Sequence (634 amino acids)

>ABZR86_RS07300 SurA N-terminal domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MLQALRTKMHGWPSIIILGICVFAISFFGIESYIVSRNDTFVAKVGKHEISQQDFQQRMN
SLRQQMVQQQGEQFDGAAFERPENKLRVLNAMVDQQLLVDAAEKMGMRISDQQLRDTIVN
LPGLQQNGKFDAGLYRAFLAGMGKTPGQFEAEVRNELNVSQLPDAFNASTLITDADIDRY
LNLSMQRRDLRYFALPRPALTDSKVDDAQIDAYYKSHQADFMNPEQVSVKYVEVSADDLK
LDVQPSEDDLKKRYEEGKQRFVMPEQRLVSHILVNVPKNATPDQQKAALAKAEQLAGQAK
EDNFAKLAEQSSDDLGSKRTGGDLGWLEKGVANPAFDEALFALQKGQISKPVLSDEGYHV
LFLRDVRSGQAKPFAEVRDQLVKEAMTGDRDRKYNEIAGKLTDSAYQNPGSLEPAAQALG
LPIKTSEMFSRQGGAGIAANPKVAQAAFADDVLAQGNNSGLIDLGNDHAVVIHVDKHVSA
AAKPLAEVRDTVRQKILDERVAAAAKAKADELLARLQKGEDMAAVAASVGAPVKTASEAT
RGLADVSPDLLDAAFKLPHPAQGKPQYASVPQQDGSFDLLALDKVQDADLSKLPAQQRDM
LRQQMARVYGDSAMREFIDALKAKTEIKIAADRM