Protein Info for ABZR86_RS07285 in Dyella japonica UNC79MFTsu3.2

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 252 (249 residues), 330.9 bits, see alignment E=2.2e-103 PF00753: Lactamase_B" amino acids 14 to 166 (153 residues), 73.9 bits, see alignment E=2.7e-24 PF12706: Lactamase_B_2" amino acids 25 to 78 (54 residues), 27.5 bits, see alignment E=3.4e-10 PF16123: HAGH_C" amino acids 167 to 252 (86 residues), 88.7 bits, see alignment E=4.1e-29

Best Hits

Swiss-Prot: 56% identical to GLO2_CUPTR: Hydroxyacylglutathione hydrolase (gloB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: None (inferred from 56% identity to bgd:bgla_1g13330)

MetaCyc: 45% identical to hydroxyacylglutathione hydrolase GloB (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FWR1 at UniProt or InterPro

Protein Sequence (254 amino acids)

>ABZR86_RS07285 hydroxyacylglutathione hydrolase (Dyella japonica UNC79MFTsu3.2)
MHVVPVPALADNYIWLLYDDAGDAIVVDPGEAAPIEAALDRRGLRLRAILLTHHHNDHIG
GVADLLAHGPVPVYAPRDERIGHVTQAVADGDEVTIAQPSARFRVLEIPGHTRSHIAYVG
AGMLLCGDTLFSMGCGRLFEGTPQQMLASLDRLADLPGELKVCCAHEYTAANGRFAQTVE
PANAALAQRVEQVRALREQAQPTLPVALATERATNPFLRVDNHDVAQWCTRHGAAADRVS
RFAALRAAKDEFRA