Protein Info for ABZR86_RS07245 in Dyella japonica UNC79MFTsu3.2

Annotation: pyruvate, water dikinase regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF03618: Kinase-PPPase" amino acids 5 to 261 (257 residues), 255.9 bits, see alignment E=2.5e-80

Best Hits

Swiss-Prot: 60% identical to PSRP_XANOR: Putative phosphoenolpyruvate synthase regulatory protein (XOO2212) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K09773, hypothetical protein (inferred from 61% identity to psu:Psesu_1440)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2FYX6 at UniProt or InterPro

Protein Sequence (271 amino acids)

>ABZR86_RS07245 pyruvate, water dikinase regulatory protein (Dyella japonica UNC79MFTsu3.2)
MRRTVFYISDSTGITAETIGNSILAQFEGVQFDKHRLPFVDDAQKAEAAALRIKTRFAQS
GERPIVVNTMASRDLCDIVAASGALMLDVFAPFIGTLEEELGAKRSGAVNRSHGLVDFDK
YEARINATNYALSHDDGIDVDYAQADLILVGVSRSGKTPTCLYMALHYGVSAANYPLTDD
DLDKLELPARLRPYRDRLFGLTIDPQRLAQIREQRRAGSRYATLQQCRWELEQAEKLMRR
EGIPSLNTTHVSIEEIASKILDRFGIERTMF