Protein Info for ABZR86_RS07160 in Dyella japonica UNC79MFTsu3.2

Annotation: signal peptidase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 51 to 71 (21 residues), see Phobius details PF10502: Peptidase_S26" amino acids 50 to 283 (234 residues), 177.6 bits, see alignment E=1.1e-56 TIGR02227: signal peptidase I" amino acids 52 to 286 (235 residues), 144.3 bits, see alignment E=1.5e-46

Best Hits

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.89

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G169 at UniProt or InterPro

Protein Sequence (304 amino acids)

>ABZR86_RS07160 signal peptidase I (Dyella japonica UNC79MFTsu3.2)
MDFDFSAILLALTVLFGVIWGLDRLFFYKSRKAGAEAAGQEEPQDPMPVDWARSLFPVVL
VVLVLRSFVAEPFRIPSGSMMPTLDVGDFILVNKFAYGLRMPAFNNKFLALGEPKRGDVV
VFRFPGYLCRVDGKLVRSGDQTCADPQAPVPSQNWIKRVIGLPGDRIEMQGDQLLINGQA
VTADQVGPYQGNPKRDEDRLMLEMGATVWNEHLRTEEGTVVNHLTARMPAYNRPPPIPSD
KVPSVVPQGCYLVMGDNRYNSTDSRWWGCLPEQNLAGKAFLVWLSWKGPDAGWVDFSRMG
KVIH