Protein Info for ABZR86_RS07105 in Dyella japonica UNC79MFTsu3.2

Annotation: hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 26 to 172 (147 residues), 61.9 bits, E=2.3e-21

Best Hits

Swiss-Prot: 34% identical to HPRT_ENTFA: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Enterococcus faecalis (strain ATCC 700802 / V583)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 55% identity to xac:XAC1335)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)
• adenine and adenosine salvage III (1/4 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A0A1I2G0J6 at UniProt or InterPro

Protein Sequence (186 amino acids)

>ABZR86_RS07105 hypoxanthine-guanine phosphoribosyltransferase (Dyella japonica UNC79MFTsu3.2)
MSTDATPTIPSLADALANADLLFDRAALEGVIADMGRRIDAALDGERAVFLTVMNGALVF
GGHLALAIRTDLEFDYVHATRYRGATTGNELHWLREPQVSLAGRVVLLVDDILDEGHTLK
AVRDDCLRRGASRVLVVSLCSKRHDRLVEGIAADFNGVELPDRYVFGFGMDYYEQGRNLP
GIYALR