Protein Info for ABZR86_RS07095 in Dyella japonica UNC79MFTsu3.2

Annotation: S-methyl-5'-thioinosine phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01694: methylthioadenosine phosphorylase
  • amino acids 5 to 246 (242 residues), 285.7 bits, E=1.3e-89
• PF01048: PNP_UDP_1
  • amino acids 5 to 246 (242 residues), 151.3 bits, E=1.5e-48

Best Hits

Swiss-Prot: 56% identical to MTIP_XANCP: Probable S-methyl-5'-thioinosine phosphorylase (XCC1285) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00772, 5'-methylthioadenosine phosphorylase [EC: 2.4.2.28] (inferred from 60% identity to psu:Psesu_1333)

MetaCyc: 57% identical to S-methyl-5'-thioinosine phosphorylase monomer (Pseudomonas aeruginosa PAO1)
RXN-12241 [EC: 2.4.2.44]

Predicted SEED Role

"5'-methylthioadenosine phosphorylase (EC 2.4.2.28)" in subsystem Methionine Salvage (EC 2.4.2.28)

MetaCyc Pathways

• L-methionine salvage cycle III (11/11 steps found)
• S-methyl-5'-thioadenosine degradation II (1/1 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• S-methyl-5'-thioadenosine degradation III (1/2 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.28 or 2.4.2.44

Sequence Analysis Tools

See A0A1I2G0Q6 at UniProt or InterPro

Protein Sequence (247 amino acids)

>ABZR86_RS07095 S-methyl-5'-thioinosine phosphorylase (Dyella japonica UNC79MFTsu3.2)
MTIDLAVIGGSGLYSFPGLENTTRHGVDTPFGKTSADVVIGDFAGKRVAFLARHGESHGV
PPHRVNYRANLWALHSLGARTVIGVNAVGGIRDDMGPRAIVVPDQVIDYTHGRYTSFCDA
EGAEVKHIDFSEPYTAALRRQLVDAAGQAGIAVIDGGCYGATQGPRLETRAEIARMKRDG
CDLVGMTGMPEAALARELELAYACLALVANFAAGCGDEAEISIDEIFAHLKAATAEVPRI
LEALLKA