Protein Info for ABZR86_RS07080 in Dyella japonica UNC79MFTsu3.2

Annotation: glucokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00749: glucokinase" amino acids 17 to 325 (309 residues), 236.4 bits, see alignment E=2.3e-74 PF02685: Glucokinase" amino acids 17 to 329 (313 residues), 321.3 bits, see alignment E=3.2e-100

Best Hits

Swiss-Prot: 49% identical to Y1460_XYLFA: Glucokinase-like protein XF_1460 (XF_1460) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 49% identity to xoo:XOO1785)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G0V1 at UniProt or InterPro

Protein Sequence (333 amino acids)

>ABZR86_RS07080 glucokinase (Dyella japonica UNC79MFTsu3.2)
MQERAWGAVVPRPKLVLAADVGGTHARIGLVDAAAPAGASGVLAYERYAGADWPGLAEIL
ADFLARHPGHAVDEAAIAVAGYVRDGELVAENLRWPVRLAELRERLRLRRLQVVNDFEAL
AFATQYLGADDSLAVIDAPAAAGPVAVVGPGTGLGCALLVPDGNGVTVLPSEGGHVALAP
GSEREMALLQLLSRGRDYVHTGHVLSGPGLVNLYRAIGELDGLSAVHAQPEQISAAALDG
GDALALDTLHTFCAMLGGFVGDLAVLFKASGGVFLAGGILPQLREFLPYSAFRERFFNKG
VMRDFLAGVPVRLIEHGRLGVLGAAGLAARAEV