Protein Info for ABZR86_RS07060 in Dyella japonica UNC79MFTsu3.2

Annotation: ABC transporter transmembrane domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 14 to 588 (575 residues), 839.8 bits, see alignment E=6e-257 PF00664: ABC_membrane" amino acids 36 to 298 (263 residues), 171.7 bits, see alignment E=2.7e-54 PF00005: ABC_tran" amino acids 368 to 517 (150 residues), 113.5 bits, see alignment E=1.3e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 62% identity to xcc:XCC1482)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1I2G127 at UniProt or InterPro

Protein Sequence (590 amino acids)

>ABZR86_RS07060 ABC transporter transmembrane domain-containing protein (Dyella japonica UNC79MFTsu3.2)
MSDSQANESSPKRRLGALRQLWPFLKPHRALAIGWLVFLSISSGSTLVLPMAVRHMIDQG
FGAANAATINLTFLGLFGVALVLAASTAARYFCITLLGERALASMRSKLYSHVIRLDVGF
FERSRVGELISRLGTDTEVVQALIGSGISVALRSMVTLVGAVVAMVWTIPRLAGFTALVI
PAMMLPILVFGRRVRKLSRASQDRLADAAAIANETLNAAPAVKAYAREDIESTRYGSAIT
RALATARKRIGTRSLLTAAVIVLMFGAITLVLWIGARDVLAGDLTPGLLSQFVLYAIFAA
GSVAGLSEVWGDVLRAAGAMERIGELLGERAEVTSPPQPQPLPKPVSGELHFDQVAFHYP
SRPDAPALHDFELRIRPGETVALVGPSGAGKSTVLALLLRFYDPQQGRITLDGVDLRALA
LPELRGAIALVPQETVIFSGTAADNIRFGRQDASDDEVRDAARAAEAHEFISALDGGYAS
ELGERGVRLSGGQRQRVAIARAILRDAPLLLLDEATSALDAQSEAAIQQALERLEKGRTT
LVIAHRLATVQRADRIVVMDGGRIVAQGTHESLLAEGGLYAELAKLQFAA